PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G003500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 339aa    MW: 39134.7 Da    PI: 6.7113
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G003500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1761.1e-54111411129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                         +ppGfrFhPtdeelv++yL+kkv++++++l +vik+vd+yk+ePwdL++      ++e+++wyfFs++dkky+tg+r+nrat++g+Wkatg
  Brast07G003500.1.p  11 VPPGFRFHPTDEELVDYYLRKKVASRRIDL-NVIKDVDLYKIEPWDLQEkcriGPEEEQSDWYFFSHKDKKYPTGTRTNRATAAGFWKATG 100
                         69****************************.99**************95343322335669****************************** PP

                 NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +dk++++ k+ lvg++ktLv+ykgrap+g+k+dW+mheyrle
  Brast07G003500.1.p 101 RDKPIYA-KHCLVGMRKTLVYYKGRAPNGHKSDWIMHEYRLE 141
                         *******.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-614161IPR003441NAC domain
PROSITE profilePS5100559.04511161IPR003441NAC domain
PfamPF023651.8E-2812140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MSNSTQQQQQ VPPGFRFHPT DEELVDYYLR KKVASRRIDL NVIKDVDLYK IEPWDLQEKC  60
RIGPEEEQSD WYFFSHKDKK YPTGTRTNRA TAAGFWKATG RDKPIYAKHC LVGMRKTLVY  120
YKGRAPNGHK SDWIMHEYRL ETNENGPPQE EGWVVCRVFK KRLPATRRDL DHDAPCWYVD  180
DDGPFLHDLN APTMNGIMPP HHSMAALQEQ HLQMLNNTYK RELKLQFQMP NHHHHHVINT  240
IIPNDLETSS FHSLLVSPDD HQVNAHHHVQ LIDHAAVDQS TTDWRVLDKF VASQLSNDAT  300
KAVDYTDEGG ILQLNEKQEG ATDYASTSTS SSQVDPWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-5051629169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934250.0JQ693425.1 Brachypodium distachyon SWN4 (SWN4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304791.10.0NAC domain-containing protein 7-like
RefseqXP_014754958.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-111NAC7_ARATH; NAC domain-containing protein 7
SwissprotF4HYV51e-111NAC26_ARATH; NAC domain-containing protein 26
TrEMBLI1H2180.0I1H218_BRADI; SWN4
STRINGBRADI1G52187.20.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP121023039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.12e-98NAC 007